Skip to content
CPC Scientific LogoCPC Scientific Logo
  • Shop Catalog
    • Search
    • Browse Catalog
    • Browse by Category
    • Catalog MSDS
    • Terms and Conditions
  • Company
  • News
  • Careers
  • My Account
    • Register
  • Contact Us
  • Services
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    GMP Peptide Manufacturing
    • Phase I, II, III & Commercial GMPHOT
    • Generic Peptide API DevelopmentHOT
    • Manufacturing Capacity
    • Cosmetic Peptides
    • Neoantigen Peptides
    Research Peptides
    • Custom Peptide Synthesis
    • FTE ServicesHOT
    • Cosmetic Peptides
    • Catalog PeptideORDER
    Oligonucleotide Services
    • GMP Oligonucleotide ManufacturingHOT
    • Oligonucleotide Services
    Peptide–Oligo Conjugate Services
    • Peptide Oligonucleotide Conjugates
    Specialties 
    • Project Management
    • Quality & Compliance
    • GMP Peptide ManufacturingHOT
      • Phase I, II, III & Commercial GMP Program OverviewHOT
      • Generic Peptide APIsHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptide Services
    • Research Peptides
      • Custom Services
        • Modifications
          • Peptide Macrocycles
          • Stapled Peptides
          • Dye Labeled Peptides
          • PEGylated Peptides
          • Click Peptides
          • Glycosylated Peptides
          • Phosphorylated Peptides
          • Peptoids
          • Unnatural Amino Acids
          • Peptide Libraries
          • Lipopeptides
          • Multiple Disulfide Bridges
          • Long Sequences
          • D-Amino Acids
          • Isotope Labeled Peptides
      • FTE ServicesHOT
      • Catalog PeptidesORDER
        • Search
        • Browse Catalog
        • Browse by Catagory
        • Catalog MSDS
        • Terms and Conditions
    • Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
    • Peptide Oligonucleotide Conjugates
      • Peptide Oligonucleotide Conjugates
    • Specialties
      • Project Management
      • Quality & Compliance
  • News & Events
    • Press Releases
    • Events
    • Videos
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Symposium
      • Symposium Overview
      • Scientific Program
      • Speakers
      • Scheduled Events
      • Contact Symposium
  • Knowledge Center
    • White Papers
    • Brochures & Flyers
    • Publications & Citations
      • Search Product Citations
      • Peer-Reviewed Publications
      • GMP Manufacturing Citations
      • Industrial CollaborationsNEW
      • GLP-1 NCE DevelopmentNEW
      • Posters
    • Articles & Insights
    • Webinars & Event Presentations
      • Webinar Series
      • Members Webinars
    • Frequently Asked Questions
    • Glossary
    • MembersPORTAL
    • Browse Knowledge Center
  • About
    • Company Profile
    • Leadership
    • Group History
    • LocationsNEW
    • Careers
  • Quote
    • Quotation Request
    • Frequently Asked Questions
    • Contact Us
  • Cart0
    CPC Scientific LogoCPC Scientific Logo
    • Services
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      GMP Peptide Manufacturing
      • Phase I, II, III & Commercial GMPHOT
      • Generic Peptide API DevelopmentHOT
      • Manufacturing Capacity
      • Cosmetic Peptides
      • Neoantigen Peptides
      Research Peptides
      • Custom Peptide Synthesis
      • FTE ServicesHOT
      • Cosmetic Peptides
      • Catalog PeptideORDER
      Oligonucleotide Services
      • GMP Oligonucleotide ManufacturingHOT
      • Oligonucleotide Services
      Peptide–Oligo Conjugate Services
      • Peptide Oligonucleotide Conjugates
      Specialties 
      • Project Management
      • Quality & Compliance
      • GMP Peptide ManufacturingHOT
        • Phase I, II, III & Commercial GMP Program OverviewHOT
        • Generic Peptide APIsHOT
        • Manufacturing Capacity
        • Cosmetic Peptides
        • Neoantigen Peptide Services
      • Research Peptides
        • Custom Services
          • Modifications
            • Peptide Macrocycles
            • Stapled Peptides
            • Dye Labeled Peptides
            • PEGylated Peptides
            • Click Peptides
            • Glycosylated Peptides
            • Phosphorylated Peptides
            • Peptoids
            • Unnatural Amino Acids
            • Peptide Libraries
            • Lipopeptides
            • Multiple Disulfide Bridges
            • Long Sequences
            • D-Amino Acids
            • Isotope Labeled Peptides
        • FTE ServicesHOT
        • Catalog PeptidesORDER
          • Search
          • Browse Catalog
          • Browse by Catagory
          • Catalog MSDS
          • Terms and Conditions
      • Oligonucleotide Services
        • GMP Oligonucleotide ManufacturingHOT
        • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
        • Peptide Oligonucleotide Conjugates
      • Specialties
        • Project Management
        • Quality & Compliance
    • News & Events
      • Press Releases
      • Events
      • Videos
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Symposium
        • Symposium Overview
        • Scientific Program
        • Speakers
        • Scheduled Events
        • Contact Symposium
    • Knowledge Center
      • White Papers
      • Brochures & Flyers
      • Publications & Citations
        • Search Product Citations
        • Peer-Reviewed Publications
        • GMP Manufacturing Citations
        • Industrial CollaborationsNEW
        • GLP-1 NCE DevelopmentNEW
        • Posters
      • Articles & Insights
      • Webinars & Event Presentations
        • Webinar Series
        • Members Webinars
      • Frequently Asked Questions
      • Glossary
      • MembersPORTAL
      • Browse Knowledge Center
    • About
      • Company Profile
      • Leadership
      • Group History
      • LocationsNEW
      • Careers
    • Quote
      • Quotation Request
      • Frequently Asked Questions
      • Contact Us
    • Cart0
      1. Home
      2. Posts
      3. Long Sequences

      Long Sequences Archive

      • Nanoparticle delivery of immunostimulatory oligonucleotides enhances response to checkpoint inhibitor therapeutics

        Buss, Colin G., and Sangeeta N. Bhatia.  Proceedings of the National Academy of Sciences (2020).

        Tandem Peptides. Tandem peptides were purchased from CPC Scientific. Sequences are: mTP-TAMRA-LyP1 (Myr-GWTLNSAGYLLGKINLKALA-ALAKKILGGGGK(5TAMRA)-CGNKRTRGC (C-C bridge)); [..] PEGylated formulations of these peptides were synthesized as previously described (49). The sequences are: [..] mTP-PEG-ARAL (Myr-GWTLNSAGYLLGKINLKALA-ALAKKILC-PEG5K-GGGARALPSQRSR).

        Published On: April 21st, 2020Categories: Citations, Dye-Labeled, Lipidation, Long Sequences, PEGylation
        Learn More
      • iRGD-guided tumor penetrating nanocomplexes for therapeutic siRNA delivery to pancreatic cancer.

        Lo, J.H., Hao, L., Muzumdar, M.D., Raghavan, S., Kwon, E.J., Pulver, E.M., Hsu, F., Aguirre, A.J., Wolpin, B.M., Fuchs, C.S. and Hahn, W.C. Molecular Cancer Therapeutics 17, no. 11 (2018): 2377-2388.

        pTP-TAMRA-iRGD (CH3(CH)15-[GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge]) used in all figures except Fig. S1 was synthesized by CPC Scientific.

        Published On: November 1st, 2019Categories: Citations, Dye-Labeled, Lipidation, Long Sequences
        Learn More
      • Tumor penetrating nanomedicine targeting both an oncomiR and an oncogene in pancreatic cancer.

        Gilles, Maud-Emmanuelle, Slack, Frank J, et al. Oncotarget, 2019, Vol. 10, (No. 51), pp: 5349-5358

        "Tandem peptide (pTP-iRGD: CH3(CH)15-GWTLNSAGYLLGKINLKALAALAKKIL-GGK(TAMRA)GGCRGDKGPDC, Cys-Cys bridge) was synthesized by CPC Scientific."

        Published On: September 3rd, 2019Categories: Citations, Dye-Labeled, Lipidation, Long Sequences
        Learn More
      • Avidity for polypeptide binding by nucleotide-bound Hsp104 structures.

        Weaver, Clarissa L., et al. Biochemistry 56.15 (2017): 2071-2075.

        "The peptide, NCysRepA50mer (C MNQSFISDIL YADIESKAKE LTVNSNNTVQ PVALMRLGVF VPKPSKSKGE), was synthesized by CPC Scientific (Sunnyvale, CA). "

        Published On: April 5th, 2017Categories: Citations, Long Sequences
        Learn More
      • Molecular and serologic markers of HPV 16 infection are associated with local recurrence in patients with oral cavity squamous cell carcinoma.

        Huang, Chung-Guei, et al. Oncotarget 8.21 (2017): 34820-34835

        "Synthetic peptides of HPV 16 L1 (N′-C-KHTPPAPKEDPLKK-C′; position: 456−471)/E6 (N′-C-RTAMFQDPQERPRK-C′; position: 5−18) and a recombination protein of full-length HPV 16 E7-histag fusion protein (N′-MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEED-EIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL-CVQSTHVDIRTLEDLLMGTLGIVCPICSQKP-C′; position: 1−98) were manufactured by CPC Scientific Inc."

        Published On: March 31st, 2017Categories: Antimicrobial Peptides, Long Sequences, Multiple Disulfide Bridges
        Learn More
      • The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.

        Skjevik, Åge Aleksander, et al. Journal of Molecular Biology 426.1 (2014): 150-168.

        "The peptides TH-(1-43) (MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIE) and THp-(1-43) (MPTPDATTPQAKGFRRAVS(PO3)2-ELDAKQAEAIMSPRFIGRRQSLIE) were synthesized by CPC Scientific (San Jose, CA) at approximately 90% purity, as seen by mass spectroscopy, and used without further purification."

        Published On: January 9th, 2014Categories: Citations, Long Sequences, Phosphorylated Peptides
        Learn More
      CPC Scientific Inc.

      Our Services

      • GMP Peptide Manufacturing
      • GMP Oligonucleotide Manufacturing
      • Custom Peptide Synthesis
      • Oligonucleotide Services
      • Peptide Oligonucleotide Conjugates
      • Generic Peptides
      • FTE Services

      Company

      • About Us
      • Group History
      • Press Releases
      • Scheduled Events
      • Careers

      Legal

      • Terms and Conditions
      • Privacy Policy

      Catalog Peptide Orders

      • Shop
      • Orders
      • Shipping Conditions
      • Order FAQs

      Support

      • Knowledge Center
      • Frequently Asked Questions
      • Contact Us

      Follow Us!

      Quotation
      CPC Scientific Inc. is a CRDMO specializing in peptide and oligonucleotide production and therapeutic development.
      We are your TIDES Partner from Concept to Commercial.

      Copyright ©2025 CPC Scientific Inc. | 3880 Atherton Rd, Rocklin, CA 95765, USA | +1 408-734-3800 | All Rights Reserved
      Page load link
      The CPC Scientific website uses cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our Privacy Policy. Accept Reject
      Go to Top